PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049367
Common NameLOC102603056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 327aa    MW: 35282.5 Da    PI: 5.2465
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049367genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.52.3e-32177234259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+ed ++v++tYeg+H h+
  PGSC0003DMP400049367 177 EDGYRWRKYGQKAVKNSPFPRSYYRCTNTKCTVKKRVERSSEDSSIVITTYEGQHCHH 234
                           8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-33161235IPR003657WRKY domain
SuperFamilySSF1182905.36E-28168234IPR003657WRKY domain
PROSITE profilePS5081129.344171236IPR003657WRKY domain
SMARTSM007742.8E-38176235IPR003657WRKY domain
PfamPF031062.8E-25177234IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDENDKQVDN DPLPSGTTGG AAAAVFTGAA SESSWSLGGG DDESDNVYFF GTSSTDRESS  60
ILTEFGWNFQ PDGNRDVRAG GDGSRFHRID EDLAGNSTTT ASASASVTEP TVTEKITDEP  120
VSSSCSDDPP EKSTASGSSS ASRPPSDTAS KVKKKGQKRI RQPRFAFMTK SEVDHLEDGY  180
RWRKYGQKAV KNSPFPRSYY RCTNTKCTVK KRVERSSEDS SIVITTYEGQ HCHHTVGFPR  240
GGLINHEAFT SQLTPLPSQF YHPSGVQYPH ELVPMSSPAA PESHTMPGET GPEPIRLPET  300
SQPDATQQPT DEGLLGDIVP PGMRSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-24164233271WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0139330.0BT013933.1 Lycopersicon esculentum clone 132931F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006348711.10.0PREDICTED: probable WRKY transcription factor 57
RefseqXP_015164806.10.0PREDICTED: probable WRKY transcription factor 57
SwissprotQ9C9835e-71WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLM1CRA20.0M1CRA2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000729580.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80312228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.23e-64WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]